Embassy of Albania in Washington, DC

Phone Number:
(202) 223-4942

Pro Tip: Dial 0 to skip the automated menu

Website:
http://www.ambasadat.gov.al/usa/en
  • Website translation available in: Albanian and English

Open Hours:

SunClosed
Mon9:00 AM 3:00 PM
Tue9:00 AM 3:00 PM
Wed9:00 AM 3:00 PM
Thu9:00 AM 3:00 PM
Fri9:00 AM 3:00 PM
SatClosed

Select an appointment slot

Services:

  • Visas
  • Passports

Tourist Visa Price:

Have a question?
Learn the answer from the Albania Embassy.

Every week, Atlys emails the Albania Embassy questions that pertain to travel visas, and we open-source the answers down below for you to read. Tap on the tabs below to filter your search.

A
Atlys
Dec 4, 2022

To: embassy washington Subject: Hello, I am a US citizen with a valid passport. I am planning on visiting Albania next month. Due to COVID-19, is there any new requirement that I should know of? ________________________________ Informacioni i trasmetuar në përmbajtje të këtij mesazhi është i destinuar vetëm për individin ose për institucionin të cilit i është nisur, mund të përmbajë materiale konfidenciale dhe / ose të privilegjuara vetëm për marrësin. Çdo rishikim, trasmetim, shpërndarje apo kryerje e ndonjë veprimi tjetër të ngjashëm me këto, nga personat apo nga subjekte të tjera të ndryshme nga marrësi i synuar,është i ndaluar. Nëse merrni gabimisht këtë mesazh, ju lutem kontaktoni urgjentisht dërguesin e tij dhe fshini çdo material të trasmetuar në kompjuterin tuaj. Ne nuk pranojmë asnjë detyrim lidhur me dëmtimin apo humbjen e shkaktuar nga programe të dëmshme apo nga viruse , përveç rastit të neglizhencës së plotë, apo sjelljes së gabuar dhe të qëllimshme.


A
Albania Embassy
Apr 11, 2022

Hello, Starting from September 6th of 2021, to enter the territory of the Republic of Albania, whether by land, sea or air, travelers must present to authorities: • A vaccination passport, valid starting from two weeks after the administration of the second dose; OR • PCR test performed up to 72 hours before entry; OR • Rapid antigen test performed within 48 hours before entry; OR • Valid document proving the traveler has recovered from infection with Covid-19, valid for up to 6 months after recovery; • These criteria also apply to those travelers who transit through Albania; • Children up to the age of 6 are exempt from these criteria; All passengers who are allowed to enter the territory of the Republic of Albania, in addition to complying with international standards protocols, applied by airlines worldwide, must also abide by the rules listed below: • Only passengers must enter the premises of airports and thus must not be escorted by their family members inside these premises; • Passengers must follow the guidelines of social distancing of 1.5 meters during the entire stay at the airport; • Priority shall be given to the elderly, people in need and families with minor children; • For more information: https://www.tirana-airport.com/c/116/measures-and-rules/ Best, ----------------------- Embassy of Albania 2100 S Street NW Washington DC 20008 Tel. +1 202 223 4942 Fax. +1 202 628 7342 E-mail. embassy.washington@mfa.gov.al ________________________________

A
Atlys
Dec 4, 2022

To: embassy washington Subject: Hey! I am a US citizen. What are the tourist visa requirements to visit Albania? How do i get a tourist visa? ________________________________ Informacioni i trasmetuar n? p?rmbajtje t? k?tij mesazhi ?sht? i destinuar vet?m p?r individin ose p?r institucionin t? cilit i ?sht? nisur, mund t? p?rmbaj? materiale konfidenciale dhe / ose t? privilegjuara vet?m p?r marr?sin. ?do rishikim, trasmetim, shp?rndarje apo kryerje e ndonj? veprimi tjet?r t? ngjash?m me k?to, nga personat apo nga subjekte t? tjera t? ndryshme nga marr?si i synuar,?sht? i ndaluar. N?se merrni gabimisht k?t? mesazh, ju lutem kontaktoni urgjentisht d?rguesin e tij dhe fshini ?do material t? trasmetuar n? kompjuterin tuaj. Ne nuk pranojm? asnj? detyrim lidhur me d?mtimin apo humbjen e shkaktuar nga programe t? d?mshme apo nga viruse , p?rve? rastit t? neglizhenc?s s? plot?, apo sjelljes s? gabuar dhe t? q?llimshme.


A
Albania Embassy
Jan 31, 2022

Hello, US Citizens may travel to Albania visa free and stay in the country for up to 90 days. If US Citizens wish to stay in Albania for a period longer than 90 days, before the completion of the 90 day period, they must apply for a residence permit at the Border and Immigration Department of the Albanian State Police. Best, ----------------------- Embassy of Albania 2100 S Street NW Washington DC 20008 Tel. +1 202 223 4942 Fax. +1 202 628 7342 E-mail. embassy.washington@mfa.gov.al ________________________________

Jurisdiction of the Embassy of Albania in Washington, DC

Before you make an appointment with this embassy, make sure that your region is in this embassy's jurisdiction. Not all regions can process paperwork at this embassy. If your region is not included, please visit the other Albania embassy locations.

  • Alabama (AL)
  • Alaska (AK)
  • American Samoa (AS)
  • Arizona (AZ)
  • Arkansas (AR)
  • California (CA)
  • Colorado (CO)
  • Commonwealth of the Northern Mariana Islands (MP)
  • Connecticut (CT)
  • Delaware (DE)
  • District of Columbia (DC)
  • Florida (FL)
  • Georgia (GA)
  • Guam (GU)
  • Hawaii (HI)
  • Idaho (ID)
  • Illinois (IL)
  • Indiana (IN)
  • Iowa (IA)
  • Kansas (KS)
  • Kentucky (KY)
  • Louisiana (LA)
  • Maine (ME)
  • Maryland (MD)
  • Massachusetts (MA)
  • Michigan (MI)
  • Minnesota (MN)
  • Mississippi (MS)
  • Missouri (MO)
  • Montana (MT)
  • Nebraska (NE)
  • Nevada (NV)
  • New Hampshire (NH)
  • New Jersey (NJ)
  • New Mexico (NM)
  • New York (NY)
  • North Carolina (NC)
  • North Dakota (ND)
  • Ohio (OH)
  • Oklahoma (OK)
  • Oregon (OR)
  • Pennsylvania (PA)
  • Puerto Rico (PR)
  • Rhode Island (RI)
  • South Carolina (SC)
  • South Dakota (SD)
  • Tennessee (TN)
  • Texas (TX)
  • United States Virgin Islands (VI)
  • Utah (UT)
  • Vermont (VT)
  • Virginia (VA)
  • Washington (WA)
  • West Virginia (WV)
  • Wisconsin (WI)
  • Wyoming (WY)
Included
Not Included
ALAKAZCOFLGAINKSMEMAMNNJNCNDOKPASDTXWYCTMOWVILNMARCADEDCHIIAKYMDMIMSMTNHNYOHORTNUTVAWAWIASGUMPNESCPRVIIDNVVTLARI